PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26045.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 404aa    MW: 44822.9 Da    PI: 10.5711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26045.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg WT+eEde+l   v+++G g+W++ +r+ g+ R++k+c++rw +yl
  mrna26045.1-v1.0-hybrid 15 RGQWTPEEDEKLFSFVQKHGHGSWRSLPRKAGLQRCGKSCRLRWKNYL 62
                             89********************************************97 PP

2Myb_DNA-binding51.72.1e-1668113148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ +Ed+ +++++++lG++ W++Ia+ ++ +Rt++++k++w+++l
  mrna26045.1-v1.0-hybrid  68 RGNFSLQEDQTIIQLHALLGNR-WSAIAAQLP-KRTDNEVKNYWNTHL 113
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.5471066IPR017930Myb domain
SuperFamilySSF466891.76E-3012109IPR009057Homeodomain-like
SMARTSM007172.2E-131464IPR001005SANT/Myb domain
PfamPF002491.4E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-241669IPR009057Homeodomain-like
CDDcd001672.09E-121862No hitNo description
PROSITE profilePS5129420.61667117IPR017930Myb domain
SMARTSM007172.3E-1667115IPR001005SANT/Myb domain
PfamPF002491.7E-1568113IPR001005SANT/Myb domain
CDDcd001677.23E-1270113No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGKQSNTAAS PGIKRGQWTP EEDEKLFSFV QKHGHGSWRS LPRKAGLQRC GKSCRLRWKN  60
YLNPDIKRGN FSLQEDQTII QLHALLGNRW SAIAAQLPKR TDNEVKNYWN THLKKRLAKK  120
GFDPVTHKPK TAILASAKGG DPKNLSNLSH IAQWETARLQ AEARFARQSK LLINNDQAPV  180
SDMNERAREI LLLLKSALAA GSGGGICSAI QVGQEIDSFG NVDVEGLLSN YDQFMAPTTS  240
TSVLDFSEVF GDYGTHNEYG ELLEALILQH NHNSAGFEVG DARSLEHNVC IVSATLDGAD  300
LTPSRTEPQP RMRPGDLLPW PSPAPPHKIG DPSHRRRSRN PAPQPCTLPP QGCCLNELLR  360
IALVQPYAPP RSNLKRRRPG SPSIRRHSPA FSRRRRRATL PRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28111173108B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375396RRRPGSPSIRRHSPAFSRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1170315e-70DQ117031.1 Fragaria vesca clone CFVCT024 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301140.10.0PREDICTED: myb-related protein Myb4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-85myb domain protein 106